PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YC
Protein Properties Length: 285aa    MW: 31849.5 Da    PI: 4.8968
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16968genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.82.8e-196861898
                      NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                               ++++P arikki+++dedv +i+  +Pvl+ska elf+ +l  r++  +     +t++   ++++v+  +ifdfl d+v +
  Tp57577_TGAC_v2_mRNA16968  6 DTRFPAARIKKIMQTDEDVGKIAMAVPVLVSKALELFLQDLCDRTYEITLRRGAKTVNAFHLKQCVQTFNIFDFLNDTVSK 86
                               5789*************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.5E-27372IPR009072Histone-fold
SuperFamilySSF471131.4E-19488IPR009072Histone-fold
PfamPF008084.9E-20871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQT DEDVGKIAMA VPVLVSKALE LFLQDLCDRT YEITLRRGAK  60
TVNAFHLKQC VQTFNIFDFL NDTVSKVPDL GGSVATDDDQ TVTKRRKVAE GDNNDSDEET  120
KRSKMPEPAQ TGGRGRGRGR GRGRGRGRGS KTADQETSLH IKFEDDSVLK QNGNHTQSNG  180
SPEIKQEPEE VKHCSPVRKP AEVFVRNIDL NMDPDDDMDF ISTPTPVPTG SSSKSISEEK  240
SEEKVDEYPG WSLSDMEKMA IDPIQLANLN KRIDEDMEDY DEEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A1e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137147RGRGRGRGRGR
2139148RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003518474.11e-131PREDICTED: dr1-associated corepressor-like
TrEMBLK7KB581e-131K7KB58_SOYBN; Uncharacterized protein
STRINGGLYMA02G44500.21e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17283491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.18e-60nuclear factor Y, subunit C11